| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
| Family a.158.1.1: F-box domain [81381] (4 proteins) |
| Protein Skp2 [81379] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
| Domain d1fqva1: 1fqv A:107-145 [19254] Other proteins in same PDB: d1fqva2, d1fqvb1, d1fqvb2, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo2, d1fqvp1, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqva1 a.158.1.1 (A:107-145) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fqva1:
View in 3DDomains from other chains: (mouse over for more information) d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |