Lineage for d4faac_ (4faa C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698066Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 1698067Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)
  6. 1698068Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 1698069Species Thermus thermophilus [TaxId:274] [81470] (24 PDB entries)
  8. 1698079Domain d4faac_: 4faa C: [192521]
    Other proteins in same PDB: d4faaa_, d4faab1, d4faab2
    automated match to d1ehkc_
    complexed with cu, cua, has, hem, olc, peo; mutant

Details for d4faac_

PDB Entry: 4faa (more details), 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant A120F+A204F from Thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d4faac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4faac_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
kpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d4faac_:

Click to download the PDB-style file with coordinates for d4faac_.
(The format of our PDB-style files is described here.)

Timeline for d4faac_: