SCOP 1.65: Domain d1fs1b1: 1fs1 B:86-140

Lineage for d1fs1b1 (1fs1 B:86-140)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (5 PDB entries)

8. Domain d1fs1b1: 1fs1 B:86-140 [19252]
   Other proteins in same PDB: d1fs1a1, d1fs1b2, d1fs1c1, d1fs1d2

Details for d1fs1b1

PDB Entry: 1fs1, 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1b1:

Sequence; same for both SEQRES and ATOM records:

>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

Timeline for d1fs1b1:

• d1fs1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1fs1b1 appears in SCOP 1.63
  
• d1fs1b1 appears in SCOP 1.67
  
• d1fs1b1 appears in the current release, SCOPe 2.08