Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d4a4wb_: 4a4w B: [192491] automated match to d3ty0a_ complexed with yfb |
PDB Entry: 4a4w (more details), 2 Å
SCOPe Domain Sequences for d4a4wb_:
Sequence, based on SEQRES records: (download)
>d4a4wb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi vtehvqllqvikktetdmslhpllqeiyk
>d4a4wb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk hitpkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv qllqvikktetdmslhpllqeiyk
Timeline for d4a4wb_: