Lineage for d1bjyb2 (1bjy B:68-208)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280146Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1280147Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)
  8. 1280177Domain d1bjyb2: 1bjy B:68-208 [19247]
    Other proteins in same PDB: d1bjya1, d1bjyb1
    complexed with ctc, mg

Details for d1bjyb2

PDB Entry: 1bjy (more details), 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
PDB Compounds: (B:) tetracycline repressor

SCOPe Domain Sequences for d1bjyb2:

Sequence, based on SEQRES records: (download)

>d1bjyb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1bjyb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOPe Domain Coordinates for d1bjyb2:

Click to download the PDB-style file with coordinates for d1bjyb2.
(The format of our PDB-style files is described here.)

Timeline for d1bjyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjyb1