Lineage for d4g4sa_ (4g4s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990638Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2990639Domain d4g4sa_: 4g4s A: [192468]
    Other proteins in same PDB: d4g4sb_, d4g4sd2, d4g4sh_, d4g4si_, d4g4sj_, d4g4sk_, d4g4sm_, d4g4sn_
    automated match to d1rypa_
    complexed with ldz, mg

Details for d4g4sa_

PDB Entry: 4g4s (more details), 2.49 Å

PDB Description: Structure of Proteasome-Pba1-Pba2 Complex
PDB Compounds: (A:) Proteasome component C7-alpha

SCOPe Domain Sequences for d4g4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4sa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsy
ifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqr
aymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkski
dhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeq
d

SCOPe Domain Coordinates for d4g4sa_:

Click to download the PDB-style file with coordinates for d4g4sa_.
(The format of our PDB-style files is described here.)

Timeline for d4g4sa_: