Lineage for d4f10a_ (4f10 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) 
incomplete toroid
Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein) Protein Alginate lyase A1-III [48232] (1 species) Species Sphingomonas sp., A1 [TaxId:28214] [48233] (5 PDB entries) 
Domain d4f10a_: 4f10 A: [192409]
Details for d4f10a_
PDB Entry: 4f10 (more details), 2.2 Å
PDB Description: alginate lyase a1-iii h192a complexed with tetrasaccharide
PDB Compounds: (A:) Alginate lyaseSCOPe Domain Sequences for d4f10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f10a_ a.102.3.1 (A:) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemv
iprrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwaka
dallnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpg
gdtsccnnasywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqs
lhyqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepq
dtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykpqg
SCOPe Domain Coordinates for d4f10a_:
Click to download the PDB-style file with coordinates for d4f10a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f10a_:
- d4f10a_ first appeared in SCOPe 2.02
- d4f10a_ appears in SCOPe 2.04
- d4f10a_ is called d4f10a1 in SCOPe 2.06
- d4f10a_ appears in the current release, SCOPe 2.08, called d4f10a1
View in 3D
