Lineage for d2tcta2 (2tct A:68-208)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280146Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1280147Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)
  8. 1280158Domain d2tcta2: 2tct A:68-208 [19240]
    Other proteins in same PDB: d2tcta1
    complexed with ctc, mg

Details for d2tcta2

PDB Entry: 2tct (more details), 2.1 Å

PDB Description: the complex formed between tet repressor and tetracycline-mg2+ reveals mechanism of antibiotic resistance
PDB Compounds: (A:) tetracycline repressor

SCOPe Domain Sequences for d2tcta2:

Sequence, based on SEQRES records: (download)

>d2tcta2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d2tcta2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOPe Domain Coordinates for d2tcta2:

Click to download the PDB-style file with coordinates for d2tcta2.
(The format of our PDB-style files is described here.)

Timeline for d2tcta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2tcta1