Lineage for d1ocor_ (1oco R:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776040Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 776041Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 776042Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 776043Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 776069Domain d1ocor_: 1oco R: [19233]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
    complexed with cmo, cu, hea, mg, na, zn

Details for d1ocor_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (R:) cytochrome c oxidase

SCOP Domain Sequences for d1ocor_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocor_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1ocor_:

Click to download the PDB-style file with coordinates for d1ocor_.
(The format of our PDB-style files is described here.)

Timeline for d1ocor_: