Lineage for d1ocoe_ (1oco E:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360132Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 360133Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 360134Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 360135Species Cow (Bos taurus) [TaxId:9913] [48482] (7 PDB entries)
  8. 360148Domain d1ocoe_: 1oco E: [19232]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_

Details for d1ocoe_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1ocoe_:

Click to download the PDB-style file with coordinates for d1ocoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ocoe_: