Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (12 PDB entries) |
Domain d4d9ra_: 4d9r A: [192316] Other proteins in same PDB: d4d9rd1, d4d9rd2, d4d9rl1, d4d9rl2 automated match to d1bioa_ complexed with cl |
PDB Entry: 4d9r (more details), 2.42 Å
SCOPe Domain Sequences for d4d9ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9ra_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d4d9ra_: