SCOPe 2.05: Domain d4avka_: 4avk A:

Lineage for d4avka_ (4avk A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)

8. Domain d4avka_: 4avk A: [192313]
   automated match to d1uwfa1
   complexed with fvq, ni, so4

Details for d4avka_

PDB Entry: 4avk, 2.4 Å

PDB Description: structure of trigonal fimh lectin domain crystal soaked with an alpha- d-mannoside o-linked to propynyl pyridine at 2.4a resolution

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4avka_:

Sequence; same for both SEQRES and ATOM records:

>d4avka_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4avka_:

• d4avka_ first appeared in SCOPe 2.02
  
• d4avka_ appears in SCOPe 2.04
  
• d4avka_ appears in SCOPe 2.06
  
• d4avka_ appears in the current release, SCOPe 2.08