Lineage for d1oczr_ (1ocz R:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922772Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 922773Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 922774Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 922775Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)
  8. 922817Domain d1oczr_: 1ocz R: [19231]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczr_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (R:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d1oczr_:

Click to download the PDB-style file with coordinates for d1oczr_.
(The format of our PDB-style files is described here.)

Timeline for d1oczr_: