Lineage for d4av5c_ (4av5 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525399Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1525404Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1525421Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1525422Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 1525426Domain d4av5c_: 4av5 C: [192305]
    automated match to d1uwfa1
    complexed with fyz, so4

Details for d4av5c_

PDB Entry: 4av5 (more details), 1.4 Å

PDB Description: Structure of a triclinic crystal of the FimH lectin domain in complex with a propynyl biphenyl alpha-D-mannoside, at 1.4 A resolution
PDB Compounds: (C:) FimH

SCOPe Domain Sequences for d4av5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4av5c_ b.2.3.2 (C:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4av5c_:

Click to download the PDB-style file with coordinates for d4av5c_.
(The format of our PDB-style files is described here.)

Timeline for d4av5c_: