Lineage for d4aeic_ (4aei C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257553Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2257569Protein Scorpion toxin [57097] (17 species)
  7. 2257624Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (4 PDB entries)
    Uniprot P01484
  8. 2257629Domain d4aeic_: 4aei C: [192295]
    Other proteins in same PDB: d4aeil1, d4aeil2, d4aeim1, d4aeim2, d4aein1, d4aein2
    automated match to d1ahoa_
    complexed with cl, epe

Details for d4aeic_

PDB Entry: 4aei (more details), 2.3 Å

PDB Description: Crystal structure of the AaHII-Fab4C1 complex
PDB Compounds: (C:) alpha-mammal toxin aah2

SCOPe Domain Sequences for d4aeic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aeic_ g.3.7.1 (C:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]}
vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
grch

SCOPe Domain Coordinates for d4aeic_:

Click to download the PDB-style file with coordinates for d4aeic_.
(The format of our PDB-style files is described here.)

Timeline for d4aeic_: