Lineage for d4aeib_ (4aei B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582033Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2582034Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2582050Protein Scorpion toxin [57097] (17 species)
  7. 2582105Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (4 PDB entries)
    Uniprot P01484
  8. 2582109Domain d4aeib_: 4aei B: [192294]
    Other proteins in same PDB: d4aeil1, d4aeil2, d4aeim1, d4aeim2, d4aein1, d4aein2
    automated match to d1ahoa_
    complexed with cl, epe

Details for d4aeib_

PDB Entry: 4aei (more details), 2.3 Å

PDB Description: Crystal structure of the AaHII-Fab4C1 complex
PDB Compounds: (B:) alpha-mammal toxin aah2

SCOPe Domain Sequences for d4aeib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aeib_ g.3.7.1 (B:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]}
vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
grch

SCOPe Domain Coordinates for d4aeib_:

Click to download the PDB-style file with coordinates for d4aeib_.
(The format of our PDB-style files is described here.)

Timeline for d4aeib_: