Lineage for d4acbc4 (4acb C:1-179)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594720Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 1594721Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 1594732Domain d4acbc4: 4acb C:1-179 [192288]
    Other proteins in same PDB: d4acba1, d4acba2, d4acba3, d4acbb1, d4acbb2, d4acbb3, d4acbc1, d4acbc2, d4acbc3, d4acbd1, d4acbd2, d4acbd3
    protein/RNA complex; complexed with 5gp, dxc, gdp, gnp, mg, so4

Details for d4acbc4

PDB Entry: 4acb (more details), 3.34 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acbc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acbc4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4acbc4:

Click to download the PDB-style file with coordinates for d4acbc4.
(The format of our PDB-style files is described here.)

Timeline for d4acbc4: