Lineage for d4acbc3 (4acb C:272-387)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1544769Protein Elongation factor SelB, domain 3 [117223] (1 species)
  7. 1544770Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
    Uniprot Q8J307
  8. 1544781Domain d4acbc3: 4acb C:272-387 [192287]
    Other proteins in same PDB: d4acba1, d4acba2, d4acba4, d4acbb1, d4acbb2, d4acbb4, d4acbc1, d4acbc2, d4acbc4, d4acbd1, d4acbd2, d4acbd4
    protein/RNA complex; complexed with 5gp, dxc, gdp, gnp, mg, so4

Details for d4acbc3

PDB Entry: 4acb (more details), 3.34 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acbc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acbc3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

SCOPe Domain Coordinates for d4acbc3:

Click to download the PDB-style file with coordinates for d4acbc3.
(The format of our PDB-style files is described here.)

Timeline for d4acbc3: