SCOP 1.67: Domain d1occe_: 1occ E:

Lineage for d1occe_ (1occ E:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (7 PDB entries)

8. Domain d1occe_: 1occ E: [19228]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occe_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occe_:

Sequence; same for both SEQRES and ATOM records:

>d1occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d1occe_:

• d1occe_ first appeared (with stable ids) in SCOP 1.55
  
• d1occe_ appears in SCOP 1.65
  
• d1occe_ appears in SCOP 1.69
  
• d1occe_ appears in the current release, SCOPe 2.08