Lineage for d1occe_ (1occ E:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217311Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 217312Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 217313Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 217314Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 217319Domain d1occe_: 1occ E: [19228]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occe_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1occe_:

Click to download the PDB-style file with coordinates for d1occe_.
(The format of our PDB-style files is described here.)

Timeline for d1occe_: