Lineage for d1occe_ (1occ E:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100830Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 100831Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 100832Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 100833Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 100838Domain d1occe_: 1occ E: [19228]
    Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occs_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occe_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1occe_:

Click to download the PDB-style file with coordinates for d1occe_.
(The format of our PDB-style files is described here.)

Timeline for d1occe_: