SCOPe 2.06: Domain d4acac4: 4aca C:1-179

Lineage for d4acac4 (4aca C:1-179)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor SelB, N-terminal domain [117537] (1 species)

7. Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
   Uniprot Q8J307

8. Domain d4acac4: 4aca C:1-179 [192272]
   Other proteins in same PDB: d4acaa1, d4acaa2, d4acaa3, d4acaa5, d4acab1, d4acab2, d4acab3, d4acac1, d4acac2, d4acac3, d4acac5, d4acad1, d4acad2, d4acad3
   complexed with 5gp, dxc, so4

Details for d4acac4

PDB Entry: 4aca, 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form

PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acac4:

Sequence; same for both SEQRES and ATOM records:

>d4acac4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Timeline for d4acac4:

• d4acac4 first appeared in SCOPe 2.02
  
• d4acac4 appears in SCOPe 2.05
  
• d4acac4 appears in SCOPe 2.07
  
• d4acac4 appears in the current release, SCOPe 2.08