SCOPe 2.04: Domain d4acac3: 4aca C:272-387

Lineage for d4acac3 (4aca C:272-387)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor SelB, domain 3 [117223] (1 species)

7. Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
   Uniprot Q8J307

8. Domain d4acac3: 4aca C:272-387 [192271]
   Other proteins in same PDB: d4acaa1, d4acaa2, d4acaa4, d4acab1, d4acab2, d4acab4, d4acac1, d4acac2, d4acac4, d4acad1, d4acad2, d4acad4
   complexed with 5gp, dxc, so4

Details for d4acac3

PDB Entry: 4aca, 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form

PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acac3:

Sequence; same for both SEQRES and ATOM records:

>d4acac3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

Timeline for d4acac3:

• d4acac3 first appeared in SCOPe 2.02
  
• d4acac3 appears in SCOPe 2.03
  
• d4acac3 appears in SCOPe 2.05
  
• d4acac3 appears in the current release, SCOPe 2.08