Lineage for d1ocrr_ (1ocr R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6267Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 6268Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 6269Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 6270Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 6274Domain d1ocrr_: 1ocr R: [19227]
    Other proteins in same PDB: d1ocra1, d1ocrb1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocrf_, d1ocrg1, d1ocrh_, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrs_, d1ocrt1, d1ocru_, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocrr_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1ocrr_:

Click to download the PDB-style file with coordinates for d1ocrr_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrr_: