![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
![]() | Protein Elongation factor SelB, domain 3 [117223] (1 species) |
![]() | Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries) Uniprot Q8J307 |
![]() | Domain d4ac9c3: 4ac9 C:272-387 [192255] Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a4, d4ac9b1, d4ac9b2, d4ac9b4, d4ac9c1, d4ac9c2, d4ac9c4, d4ac9d1, d4ac9d2, d4ac9d4 protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4 |
PDB Entry: 4ac9 (more details), 3.03 Å
SCOPe Domain Sequences for d4ac9c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac9c3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni
Timeline for d4ac9c3: