Lineage for d4ac9b4 (4ac9 B:1-179)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594720Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 1594721Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 1594723Domain d4ac9b4: 4ac9 B:1-179 [192252]
    Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a3, d4ac9b1, d4ac9b2, d4ac9b3, d4ac9c1, d4ac9c2, d4ac9c3, d4ac9d1, d4ac9d2, d4ac9d3
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9b4

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (B:) mj0495-like protein

SCOPe Domain Sequences for d4ac9b4:

Sequence, based on SEQRES records: (download)

>d4ac9b4 c.37.1.8 (B:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Sequence, based on observed residues (ATOM records): (download)

>d4ac9b4 c.37.1.8 (B:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiakrgitidigfsafklenyritlvdapghadl
iravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrt
emimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4ac9b4:

Click to download the PDB-style file with coordinates for d4ac9b4.
(The format of our PDB-style files is described here.)

Timeline for d4ac9b4: