Lineage for d2occr_ (2occ R:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096546Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 1096547Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 1096548Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1096549Species Cow (Bos taurus) [TaxId:9913] [48482] (23 PDB entries)
  8. 1096580Domain d2occr_: 2occ R: [19225]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occr_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (R:) cytochrome c oxidase

SCOPe Domain Sequences for d2occr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2occr_:

Click to download the PDB-style file with coordinates for d2occr_.
(The format of our PDB-style files is described here.)

Timeline for d2occr_: