Lineage for d4ac9b1 (4ac9 B:180-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793043Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 2793044Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 2793047Domain d4ac9b1: 4ac9 B:180-271 [192249]
    Other proteins in same PDB: d4ac9a3, d4ac9a4, d4ac9a5, d4ac9b3, d4ac9b4, d4ac9c3, d4ac9c4, d4ac9c5, d4ac9d3, d4ac9d4
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9b1

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (B:) mj0495-like protein

SCOPe Domain Sequences for d4ac9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac9b1 b.43.3.1 (B:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d4ac9b1:

Click to download the PDB-style file with coordinates for d4ac9b1.
(The format of our PDB-style files is described here.)

Timeline for d4ac9b1: