Lineage for d2occe_ (2occ E:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285243Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 285244Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 285245Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 285246Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 285249Domain d2occe_: 2occ E: [19224]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_

Details for d2occe_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2occe_:

Click to download the PDB-style file with coordinates for d2occe_.
(The format of our PDB-style files is described here.)

Timeline for d2occe_: