Lineage for d2occe_ (2occ E:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155820Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)
  4. 156085Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 156086Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 156087Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 156088Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 156091Domain d2occe_: 2occ E: [19224]
    Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occf_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occs_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occe_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2occe_:

Click to download the PDB-style file with coordinates for d2occe_.
(The format of our PDB-style files is described here.)

Timeline for d2occe_: