Lineage for d1hx8a_ (1hx8 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285231Superfamily a.118.10: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48473] (1 family) (S)
  5. 285232Family a.118.10.1: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48474] (2 proteins)
  6. 285233Protein AP180 (Lap) [48477] (1 species)
  7. 285234Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48478] (1 PDB entry)
  8. 285235Domain d1hx8a_: 1hx8 A: [19222]

Details for d1hx8a_

PDB Entry: 1hx8 (more details), 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180

SCOP Domain Sequences for d1hx8a_:

Sequence, based on SEQRES records: (download)

>d1hx8a_ a.118.10.1 (A:) AP180 (Lap) {Fruit fly (Drosophila melanogaster)}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtvqdggmgvpggrmgydmspfirrya
kylnekslsyramafdfckvkrgkeegslrsmnaekllktlpvlqaqldallefdcqsnd
lsngvinmsfmllfrdlirlfacyndgiinllekyfdmnkkhardaldlykkflvrmdrv
geflkvaenvgidkgdipdltkapsslldaleqhlatl

Sequence, based on observed residues (ATOM records): (download)

>d1hx8a_ a.118.10.1 (A:) AP180 (Lap) {Fruit fly (Drosophila melanogaster)}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtggmgvpggrmgydmspfirryakyl
nekslsyramafdfckvegslrsmnaekllktlpvlqaqldallefdcqsndlsngvinm
sfmllfrdlirlfacyndgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvae
nvgidkgdipdltkapsslldaleqhlatl

SCOP Domain Coordinates for d1hx8a_:

Click to download the PDB-style file with coordinates for d1hx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hx8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hx8b_