Lineage for d1hg5a_ (1hg5 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6256Superfamily a.118.10: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48473] (1 family) (S)
  5. 6257Family a.118.10.1: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48474] (2 proteins)
  6. 6262Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [48475] (1 species)
  7. 6263Species Rat (Rattus norvegicus) [TaxId:10116] [48476] (3 PDB entries)
  8. 6266Domain d1hg5a_: 1hg5 A: [19221]

Details for d1hg5a_

PDB Entry: 1hg5 (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex

SCOP Domain Sequences for d1hg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg5a_ a.118.10.1 (A:) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvkrgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafm
llfkdairlfaaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvg
idrgdipdlsqapsslldaleqh

SCOP Domain Coordinates for d1hg5a_:

Click to download the PDB-style file with coordinates for d1hg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hg5a_: