Lineage for d3vjha_ (3vjh A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (82 PDB entries)
    Uniprot P37231 232-505
  8. 1280720Domain d3vjha_: 3vjh A: [192205]
    automated match to d3ty0a_
    complexed with j35

Details for d3vjha_

PDB Entry: 3vjh (more details), 2.22 Å

PDB Description: human ppar gamma ligand binding domain in complex with jkpl35
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3vjha_:

Sequence, based on SEQRES records: (download)

>d3vjha_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivtehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d3vjha_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkk
evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
ikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3vjha_:

Click to download the PDB-style file with coordinates for d3vjha_.
(The format of our PDB-style files is described here.)

Timeline for d3vjha_: