Lineage for d1hfaa_ (1hfa A:)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.10: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48473] (1 family) 
Family a.118.10.1: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48474] (2 proteins) Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [48475] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48476] (4 PDB entries) 
Domain d1hfaa_: 1hfa A: [19220]
complexed with pio
Details for d1hfaa_
PDB Entry: 1hfa (more details), 2 Å
PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, pi(4,5)p2 complex
SCOP Domain Sequences for d1hfaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfaa_ a.118.10.1 (A:) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvkrgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafm
llfkdairlfaaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvg
idrgdipdlsqapsslldaleqh
SCOP Domain Coordinates for d1hfaa_:
Click to download the PDB-style file with coordinates for d1hfaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfaa_:
- d1hfaa_ first appeared (with stable ids) in SCOP 1.55
- d1hfaa_ appears in SCOP 1.63
- d1hfaa_ does not appear in SCOP 1.67
View in 3D