Lineage for d1hf8a_ (1hf8 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285231Superfamily a.118.10: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48473] (1 family) (S)
  5. 285232Family a.118.10.1: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48474] (2 proteins)
  6. 285237Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [48475] (1 species)
  7. 285238Species Rat (Rattus norvegicus) [TaxId:10116] [48476] (4 PDB entries)
  8. 285239Domain d1hf8a_: 1hf8 A: [19219]

Details for d1hf8a_

PDB Entry: 1hf8 (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein

SCOP Domain Sequences for d1hf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf8a_ a.118.10.1 (A:) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvkrgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafm
llfkdairlfaaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvg
idrgdipdlsqapsslldaleqh

SCOP Domain Coordinates for d1hf8a_:

Click to download the PDB-style file with coordinates for d1hf8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hf8a_: