Lineage for d3un8r_ (3un8 R:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228696Domain d3un8r_: 3un8 R: [192185]
    Other proteins in same PDB: d3un8a_, d3un8e_, d3un8f_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8s_, d3un8t_, d3un8w_, d3un8x_, d3un8y_, d3un8z_
    automated match to d1jd2y_
    complexed with 049

Details for d3un8r_

PDB Entry: 3un8 (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3un8r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3un8r_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3un8r_:

Click to download the PDB-style file with coordinates for d3un8r_.
(The format of our PDB-style files is described here.)

Timeline for d3un8r_: