Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d3un8r_: 3un8 R: [192185] Other proteins in same PDB: d3un8a_, d3un8e_, d3un8f_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8s_, d3un8t_, d3un8w_, d3un8x_, d3un8y_, d3un8z_ automated match to d1jd2y_ complexed with 049 |
PDB Entry: 3un8 (more details), 2.7 Å
SCOPe Domain Sequences for d3un8r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3un8r_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
Timeline for d3un8r_: