Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [192454] (4 PDB entries) |
Domain d3u7na1: 3u7n A:1-183 [192167] Other proteins in same PDB: d3u7na2 automated match to d1lmha_ complexed with uhf, zn |
PDB Entry: 3u7n (more details), 2.3 Å
SCOPe Domain Sequences for d3u7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u7na1 d.167.1.1 (A:1-183) automated matches {Staphylococcus aureus [TaxId: 93062]} mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda vev
Timeline for d3u7na1: