SCOPe 2.08: Domain d3tyib_: 3tyi B:

Lineage for d3tyib_ (3tyi B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d3tyib_: 3tyi B: [192163]
   automated match to d2ycca_
   complexed with hem, t3y

Details for d3tyib_

PDB Entry: 3tyi, 1.4 Å

PDB Description: crystal structure of cytochrome c - p-sulfonatocalix[4]arene complexes

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d3tyib_:

Sequence; same for both SEQRES and ATOM records:

>d3tyib_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d3tyib_:

• d3tyib_ first appeared in SCOPe 2.02
  
• d3tyib_ appears in SCOPe 2.07