Lineage for d3tyia_ (3tyi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691050Domain d3tyia_: 3tyi A: [192162]
    automated match to d2ycca_
    complexed with hem, t3y

Details for d3tyia_

PDB Entry: 3tyi (more details), 1.4 Å

PDB Description: crystal structure of cytochrome c - p-sulfonatocalix[4]arene complexes
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d3tyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d3tyia_:

Click to download the PDB-style file with coordinates for d3tyia_.
(The format of our PDB-style files is described here.)

Timeline for d3tyia_: