Lineage for d3tofa_ (3tof A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067823Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)
  8. 2067838Domain d3tofa_: 3tof A: [192151]
    automated match to d1sdta_
    complexed with 076, act, dms

Details for d3tofa_

PDB Entry: 3tof (more details), 1.45 Å

PDB Description: hiv-1 protease - epoxydic inhibitor complex (ph 6 - orthorombic crystal form p212121)
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3tofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tofa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3tofa_:

Click to download the PDB-style file with coordinates for d3tofa_.
(The format of our PDB-style files is described here.)

Timeline for d3tofa_: