Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries) |
Domain d3t5wi_: 3t5w I: [192117] automated match to d1hl5a_ complexed with cu1, so4, zn |
PDB Entry: 3t5w (more details), 1.8 Å
SCOPe Domain Sequences for d3t5wi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t5wi_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d3t5wi_: