SCOPe 2.06: Domain d3swsc1: 3sws C:7-131

Lineage for d3swsc1 (3sws C:7-131)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein Methylamine dehydrogenase [57563] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)

8. Domain d3swsc1: 3sws C:7-131 [192088]
   Other proteins in same PDB: d3swsc2, d3swsd_, d3swsf_
   automated match to d2bbkl_
   complexed with 1pe, act, ca, edo, hec, mes, na, pg4

Details for d3swsc1

PDB Entry: 3sws, 1.86 Å

PDB Description: Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3swsc1:

Sequence; same for both SEQRES and ATOM records:

>d3swsc1 g.21.1.1 (C:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d3swsc1:

• d3swsc1 first appeared in SCOPe 2.02, called d3swsc_
  
• d3swsc1 was called d3swsc_ in SCOPe 2.05
  
• d3swsc1 appears in SCOPe 2.07
  
• d3swsc1 appears in the current release, SCOPe 2.08