SCOPe 2.06: Domain d3sdig_: 3sdi G:

Lineage for d3sdig_ (3sdi G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3sdig_: 3sdi G: [192063]
   Other proteins in same PDB: d3sdib_, d3sdid_, d3sdie_, d3sdif_, d3sdip_, d3sdir_, d3sdis_, d3sdit_
   automated match to d1jd22_
   complexed with 3sd, mes, mg

Details for d3sdig_

PDB Entry: 3sdi, 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20

PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3sdig_:

Sequence; same for both SEQRES and ATOM records:

>d3sdig_ d.153.1.4 (G:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyi
fcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqra
ymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskid
hineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd

Timeline for d3sdig_:

• d3sdig_ first appeared in SCOPe 2.02
  
• d3sdig_ appears in SCOPe 2.05
  
• d3sdig_ appears in SCOPe 2.07
  
• d3sdig_ appears in the current release, SCOPe 2.08