Lineage for d3sdig_ (3sdi G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2552090Domain d3sdig_: 3sdi G: [192063]
    Other proteins in same PDB: d3sdib_, d3sdid_, d3sdie_, d3sdif_, d3sdip_, d3sdir_, d3sdis_, d3sdit_
    automated match to d1jd22_
    complexed with 3sd, mes, mg

Details for d3sdig_

PDB Entry: 3sdi (more details), 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3sdig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdig_ d.153.1.4 (G:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyi
fcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqra
ymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskid
hineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd

SCOPe Domain Coordinates for d3sdig_:

Click to download the PDB-style file with coordinates for d3sdig_.
(The format of our PDB-style files is described here.)

Timeline for d3sdig_: