SCOPe 2.03: Domain d3rwbb_: 3rwb B:

Lineage for d3rwbb_ (3rwb B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:381] [189923] (3 PDB entries)

8. Domain d3rwbb_: 3rwb B: [191989]
   automated match to d3nuga_
   complexed with 4pl, gol, nad

Details for d3rwbb_

PDB Entry: 3rwb, 1.7 Å

PDB Description: Crystal structure of complex of 4PAL (4-Pyridoxolactone) and PLDH (tetrameric pyridoxal 4-dehydrogenase) from Mesorhizobium loti

PDB Compounds: (B:) Pyridoxal 4-dehydrogenase

SCOPe Domain Sequences for d3rwbb_:

Sequence; same for both SEQRES and ATOM records:

>d3rwbb_ c.2.1.0 (B:) automated matches {Mesorhizobium loti [TaxId: 381]}
terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
dagmvrh

Timeline for d3rwbb_:

• d3rwbb_ first appeared in SCOPe 2.02
  
• d3rwbb_ appears in SCOPe 2.04
  
• d3rwbb_ appears in the current release, SCOPe 2.08