Lineage for d3r5ve_ (3r5v E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790843Protein automated matches [191079] (5 species)
    not a true protein
  7. 2790870Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries)
  8. 2790885Domain d3r5ve_: 3r5v E: [191967]
    automated match to d3q5va_
    complexed with ca, mpd, mrd

Details for d3r5ve_

PDB Entry: 3r5v (more details), 1.65 Å

PDB Description: the structure of calcium bound thermococcus thioreducens inorganic pyrophosphatase at 298k
PDB Compounds: (E:) Tt-IPPase

SCOPe Domain Sequences for d3r5ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r5ve_ b.40.5.1 (E:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekf

SCOPe Domain Coordinates for d3r5ve_:

Click to download the PDB-style file with coordinates for d3r5ve_.
(The format of our PDB-style files is described here.)

Timeline for d3r5ve_: