Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries) Uniprot P01887 |
Domain d3pwub_: 3pwu B: [191926] automated match to d1lk2b_ |
PDB Entry: 3pwu (more details), 1.9 Å
SCOPe Domain Sequences for d3pwub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwub_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d3pwub_: