Lineage for d3oevr_ (3oev R:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439383Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (16 PDB entries)
  8. 1439405Domain d3oevr_: 3oev R: [191912]
    Other proteins in same PDB: d3oev1_, d3oev2_, d3oeva_, d3oevc_, d3oeve_, d3oevg_, d3oevh_, d3oevi_, d3oevj_, d3oevk_, d3oevl_, d3oevm_, d3oevn_, d3oevo_, d3oevq_, d3oevs_, d3oevu_, d3oevv_, d3oevw_, d3oevx_, d3oevy_, d3oevz_
    automated match to d1jd2y_
    complexed with 3oe, mes, mg

Details for d3oevr_

PDB Entry: 3oev (more details), 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3oevr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oevr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3oevr_:

Click to download the PDB-style file with coordinates for d3oevr_.
(The format of our PDB-style files is described here.)

Timeline for d3oevr_: