SCOPe 2.02: Domain d3oevr_: 3oev R:

Lineage for d3oevr_ (3oev R:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (8 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [189752] (11 PDB entries)

8. Domain d3oevr_: 3oev R: [191912]
   Other proteins in same PDB: d3oevu_, d3oevy_
   automated match to d1jd2y_
   complexed with 3oe, mes, mg

Details for d3oevr_

PDB Entry: 3oev, 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25

PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3oevr_:

Sequence; same for both SEQRES and ATOM records:

>d3oevr_ d.153.1.4 (R:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d3oevr_:

• d3oevr_ is new in SCOPe 2.02-stable
  
• d3oevr_ appears in SCOPe 2.03
  
• d3oevr_ appears in the current release, SCOPe 2.08