Lineage for d1dcea1 (1dce A:1-241,A:351-443)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542934Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 542935Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 543029Protein Rab geranylgeranyltransferase alpha-subunit, N-terminal domain [48443] (1 species)
  7. 543030Species Rat (Rattus norvegicus) [TaxId:10116] [48444] (2 PDB entries)
  8. 543031Domain d1dcea1: 1dce A:1-241,A:351-443 [19191]
    Other proteins in same PDB: d1dcea2, d1dcea3, d1dceb_, d1dcec2, d1dcec3, d1dced_

Details for d1dcea1

PDB Entry: 1dce (more details), 2 Å

PDB Description: crystal structure of rab geranylgeranyltransferase from rat brain

SCOP Domain Sequences for d1dcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus)}
mhgrlkvktseeqaeakrlereqklklyqsatqavfqkrqageldesvleltsqilganp
dfatlwncrrevlqhletekspeesaalvkaelgflesclrvnpksygtwhhrcwllsrl
pepnwarelelcarfleadernfhcwdyrrfvaaqaavapaeelaftdslitrnfsnyss
whyrscllpqlhpqpdsgpqgrlpenvllkelelvqnafftdpndqsawfyhrwllgrae
pXlfrcelsvekstvlqselesckelqelepenkwclltiillmraldpllyeketlqyf
stlkavdpmraaylddlrskfllensvlkmeyadv

SCOP Domain Coordinates for d1dcea1:

Click to download the PDB-style file with coordinates for d1dcea1.
(The format of our PDB-style files is described here.)

Timeline for d1dcea1: